PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0146s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 724aa    MW: 78774.1 Da    PI: 9.1847
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0146s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.6e-094204571954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  SapurV1A.0146s0010.1.p 420 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 457
                             554459******************************88 PP

2BELL100.99.6e-33296366272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             rq+l+ kk kL+++l+e ++rY+qy++q+q+v+s Fe++ag g+ak+Yt+lAl++iS++Fr+Lk+ i++qi
  SapurV1A.0146s0010.1.p 296 RQDLRTKKGKLVKMLDEAEQRYRQYHHQMQVVVSLFEQAAGFGAAKSYTALALQTISKKFRSLKNTISSQI 366
                             7899******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-51220364IPR006563POX domain
PfamPF075263.1E-42225363IPR006563POX domain
PROSITE profilePS5007112.179398461IPR001356Homeobox domain
SMARTSM003892.3E-9401465IPR001356Homeobox domain
CDDcd000862.58E-12401462No hitNo description
SuperFamilySSF466895.99E-17402467IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29404467IPR009057Homeodomain-like
PfamPF059203.0E-18418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MATYFHGSSE IQAAAAPSDG IQTLYLMNPN YLSSYAESTQ QQHQHQQQPP NMIFFNPSSS  60
TAASNNVLKT GKLPHAPPQN HHFVGIPLAA PSSNITSLTP DSNSRRPPLH GVVPSHVHYS  120
IWGSIDQNSF ATACESSAAS VVGSPQVGFR RPVAVSPGRQ GLSLSLSSQQ APTPYNRAIS  180
NNHHEIHALH SHVSVGSSGD EIRISGNSSS SVSAVSNGVS GLQNMVLGSK YLRAAQELLD  240
EAVNVGKDLV KRGLIEGSSK ERMEMTKEYS ITGDGTGGGG ETSAANRGAE LTTALRQDLR  300
TKKGKLVKML DEAEQRYRQY HHQMQVVVSL FEQAAGFGAA KSYTALALQT ISKKFRSLKN  360
TISSQIRATS KSLGEEDCVG AKVEGSRLRH VDHQLRQHND WRPQRGLPER AVSVLRAWLF  420
EHFLHPYPKD SDKHMLAKQT GLTRSQVSNW FINARVRLWK PMVEEMYVEE IKEQDSSEEN  480
ASKKDKIDSG SHYTAPGESS SLQMDQLKGV LHSKQLKKPS NQNASPVKFS YPTISMTMGA  540
PLQQQAGFTL IGPAEMEGIS RRSSTEPSSE MQNPPSSILS MDMDAKQGET SREINVDFGG  600
ERLIKDGYPL IASSGGFGAY PMGDLGRFNL EQLTPRFSAN GVSLTLGLPH CENLSLPGTE  660
QNYLSNQNIQ LGGKRRLKIG SGTEPGFSGI ITSQNSHSSS GFERIDIQNR TRFPAQLLPD  720
FVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-17407465563Homeobox protein Meis2
3k2a_B9e-17407465563Homeobox protein Meis2
4xrs_A9e-17407464158Homeobox protein Meis1
4xrs_B9e-17407464158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2323520.0CU232352.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011003835.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011003836.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011003838.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011003839.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011003840.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011003841.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLB9HQ650.0B9HQ65_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02250.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-115BEL1-like homeodomain 1